{"product_id":"proteintech-12928-1-ap","title":"Proteintech, 12928-1-AP, IRF6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF6 (12928-1-AP) by Proteintech is a Polyclonal antibody targeting IRF6 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12928-1-AP targets IRF6 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A549 cells,  HaCaT cells\nPositive IHC detected in: human lung tissue, mouse kidney tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe interferon regulatory factor (IRF) family of genes directs the expression and activity of interferon and thus can strictly regulate innate immunity. Interferon regulatory factor 6 (IRF6) belongs to a family of nine transcription factors that share a highly conserved helix−turn−helix DNA-binding domain and a less conserved protein-binding domain. IRF6 regulates the balance between immature ectoderm differentiation and proliferation during craniofacial morphogenesis. IRF6 functions as a tumor suppressor gene in breast cancer, cervical cancer, nasopharyngeal carcinoma and so on.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3623 Product name: Recombinant human IRF6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-467 aa of BC014852 Sequence: LNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLETFLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ Predict reactive species\nFull Name: interferon regulatory factor 6\nCalculated Molecular Weight: 467 aa, 53 kDa\nObserved Molecular Weight: 53-60 kDa\nGenBank Accession Number: BC014852\nGene Symbol: IRF6\nGene ID (NCBI): 3664\nRRID: AB_3085402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14896\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869699330217,"sku":"12928-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12928-1-ap","provider":"Iright","version":"1.0","type":"link"}