{"product_id":"proteintech-12933-1-ap","title":"Proteintech, 12933-1-AP, KCNMB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNMB1 (12933-1-AP) by Proteintech is a Polyclonal antibody targeting KCNMB1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12933-1-AP targets KCNMB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse skeletal muscle tissue,  rat brain tissue,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcium-activated potassium channel subunit beta-1 is a protein encoded by KCNMB1 gene, also named as BK beta1, slo beta1. MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Beta subunits (beta 1-4) are highly tissue specific in their expression, with beta-1 being present predominantly on vascular smooth muscle. Endothelial cells are not known to express beta1, subunits. Beta1, is also known to be expressed in urinary bladder and in some regions of the brain. Association of the beta-1 subunit with the BK channel increases the apparent Ca2+ sensitivity of the channel and decreases voltage dependence.PMID 25015960\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3888 Product name: Recombinant human KCNMB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC025707 Sequence: MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRG Predict reactive species\nFull Name: potassium large conductance calcium-activated channel, subfamily M, beta member 1\nCalculated Molecular Weight: 130aa,15 kDa; 190aa,22 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC025707\nGene Symbol: KCNMB1\nGene ID (NCBI): 3779\nRRID: AB_3669151\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16558\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887691845801,"sku":"12933-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12933-1-ap","provider":"Iright","version":"1.0","type":"link"}