{"product_id":"proteintech-12956-1-ap","title":"Proteintech, 12956-1-AP, LIPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIPA (12956-1-AP) by Proteintech is a Polyclonal antibody targeting LIPA in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12956-1-AP targets LIPA in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  RAW 264.7 cells,  NIH\/3T3 cells\nPositive IP detected in: HT-1080 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman acid lipase\/cholesteryl esterase (LIPA) is a 46-kDa glycoprotein required for the lysosomal hydrolysis of cholesteryl esters and triglycerides that cells acquire through the receptor-mediated endocytosis of low-density lipoproteins(PMID:8432549). Defects in LIPA are the cause of Wolman disease (WOD)(PMID:8146180) and cholesteryl ester storage disease (CESD)(PMID:9633819). It has 2 isoforms produced by alternative splicing with the molecular weight of 45 kDa and 39 kDa. The full length protein has a signal peptide and several glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3627 Product name: Recombinant human LIPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-200 aa of BC012287 Sequence: WPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFAL Predict reactive species\nFull Name: lipase A, lysosomal acid, cholesterol esterase\nCalculated Molecular Weight: 399 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC012287\nGene Symbol: LIPA\nGene ID (NCBI): 3988\nRRID: AB_2078477\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P38571\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913062057,"sku":"12956-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12956-1-ap","provider":"Iright","version":"1.0","type":"link"}