{"product_id":"proteintech-13000-1-ap","title":"Proteintech, 13000-1-AP, DOCK7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOCK7 (13000-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK7 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13000-1-AP targets DOCK7 in WB, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HepG2 cells,  human brain tissue,  mouse brain tissue,  mouse ovary tissue,  Jurkat cells,  HeLa cells,  K-562 cells,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDOCK 7 (dedicator of cytokinesis 7), also known as ZIR2, is a member of the DOCK180-related protein superfamily. Expressed mainly in neuronal cells, DOCK 7 is a guanine nucleotide exchange factor (GEF) for small GTPases, Rac1 and Cdc42, which are the major regulators of actin cytoskeleton. Multiple isoforms of DOCK 7 exist due to alternative splicing events. The DOCK 7 antibody (13000-1-AP) can recognize all the isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3671 Product name: Recombinant human DOCK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 447-798 aa of BC016392 Sequence: MAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL Predict reactive species\nFull Name: dedicator of cytokinesis 7\nCalculated Molecular Weight: 2109 aa, 239 kDa\nObserved Molecular Weight: 238-243 kDa\nGenBank Accession Number: BC016392\nGene Symbol: DOCK7\nGene ID (NCBI): 85440\nRRID: AB_10646476\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96N67\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868954513577,"sku":"13000-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13000-1-ap","provider":"Iright","version":"1.0","type":"link"}