{"product_id":"proteintech-13013-1-ap","title":"Proteintech, 13013-1-AP, NKX2-2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NKX2-2 (13013-1-AP) by Proteintech is a Polyclonal antibody targeting NKX2-2 in WB, IHC, IF, ELISA applications with reactivity to human, mouse, rat samples\n13013-1-AP targets NKX2-2 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Min6 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF detected in: E16.5 mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF): IF : 1:20 - 1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4069 Product name: Recombinant human NKX2-2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC075092 Sequence: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKR Predict reactive species\nFull Name: NK2 homeobox 2\nCalculated Molecular Weight: 273 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC075092\nGene Symbol: NKX2-2\nGene ID (NCBI): 4821\nRRID: AB_2877903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95096\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943339689,"sku":"13013-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13013-1-ap","provider":"Iright","version":"1.0","type":"link"}