{"product_id":"proteintech-13025-1-ap","title":"Proteintech, 13025-1-AP, L-Plastin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe L-Plastin (13025-1-AP) by Proteintech is a Polyclonal antibody targeting L-Plastin in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13025-1-AP targets L-Plastin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  mouse spleen tissue,  RAW 264.7 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLCP1, also known as L-Plastin, is a member of the Plastin gene family. The family members include L-Plastin (LCP1), T-Plastin (PLS3), and I-Plastin (PLS1), which can regulate the dynamic reorganization of the cytoskeleton by binding and cross-linking actin filaments. In lymphocytes, LCP1 can regulate immune responses, especially during inflammation and infection. It acts as a key regulator of T-cell activation by responding to co-stimulatory signals through TCR\/CD3 and CD2 or CD28, and regulates the cell-surface expression of IL2RA\/CD25 and CD69 (PMID: 17294403).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey, zebrafish, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3571 Product name: Recombinant human LCP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-627 aa of BC010271 Sequence: LENAGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAEKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV Predict reactive species\nFull Name: lymphocyte cytosolic protein 1 (L-plastin)\nCalculated Molecular Weight: 627 aa, 64 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC010271\nGene Symbol: L-Plastin\nGene ID (NCBI): 3936\nRRID: AB_2136871\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13796\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934623401,"sku":"13025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13025-1-ap","provider":"Iright","version":"1.0","type":"link"}