{"product_id":"proteintech-13056-1-ap","title":"Proteintech, 13056-1-AP, LXN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LXN (13056-1-AP) by Proteintech is a Polyclonal antibody targeting LXN in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13056-1-AP targets LXN in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLatexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3726 Product name: Recombinant human LXN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC005346 Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE Predict reactive species\nFull Name: latexin\nCalculated Molecular Weight: 222 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC005346\nGene Symbol: LXN\nGene ID (NCBI): 56925\nRRID: AB_2139511\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BS40\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869414903977,"sku":"13056-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13056-1-ap","provider":"Iright","version":"1.0","type":"link"}