{"product_id":"proteintech-13058-1-ap","title":"Proteintech, 13058-1-AP, MACF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MACF1 (13058-1-AP) by Proteintech is a Polyclonal antibody targeting MACF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n13058-1-AP targets MACF1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-87 MG cells, NIH\/3T3 cells,  mouse lung tissue\nPositive IHC detected in: human lung tissue, human skeletal muscle tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells, NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMACF1, also called ACF7 (actin crosslinking family 7), is a member of the spectraplakin family and is a ubiquitously expressed 614 kDa protein. This protein facilitates actin-microtubule interactions at the cell periphery and couples the microtubule network to cellular junctions. It displays a conserved role in membrane protrusion formation during evolution. The two major MACF1 isoforms characterized to date, MACF1a and MACF1b, result from alternative splicing. Both proteins contain N-terminal actin-binding domains (ABD), followed by plakin domains, extended spectrin repeat domains, EF-hand motifs, and C-terminal microtubule-binding domains (MTBDs). MACF1 is expressed in numerous tissue, including the skin, brain, skeletal muscle, and heart.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3730 Product name: Recombinant human MACF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-305 aa of BC007330 Sequence: EDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKTSLQFSRCYDKPWLVNSKAGTPIRDSHSPDLQLPTPEVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR Predict reactive species\nFull Name: microtubule-actin crosslinking factor 1\nCalculated Molecular Weight: 5430 aa, 620 kDa\nObserved Molecular Weight: 600 kDa\nGenBank Accession Number: BC007330\nGene Symbol: MACF1\nGene ID (NCBI): 23499\nRRID: AB_2877907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868942586025,"sku":"13058-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13058-1-ap","provider":"Iright","version":"1.0","type":"link"}