{"product_id":"proteintech-13089-1-ap","title":"Proteintech, 13089-1-AP, TRX2\/TXN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRX2\/TXN2 (13089-1-AP) by Proteintech is a Polyclonal antibody targeting TRX2\/TXN2 in WB, IHC, ELISA applications with reactivity to human samples\n13089-1-AP targets TRX2\/TXN2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells,  human liver tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXN2 (Thioredoxin-2) is also named as TRX2, MTRX, Mt-TRX and regulates the mitochondrial redox state and plays an important role in cell proliferation. It has been shown that cells conditionally deficient in Trx2 undergo apoptosis in the absence of exogenous stress, accompanied by an accumulation of intracellular ROS, the activation of caspase 9 and caspase 3, and the release of cytochrome c into the cytosol. In the retina, the expression profile and the role of Trx2 have not yet been defined (PMID: 18441302).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3640 Product name: Recombinant human TRX2,TXN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC013726 Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Predict reactive species\nFull Name: thioredoxin 2\nCalculated Molecular Weight: 166 aa, 18 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC013726\nGene Symbol: Thioredoxin 2\nGene ID (NCBI): 25828\nRRID: AB_2304119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99757\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868856078505,"sku":"13089-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13089-1-ap","provider":"Iright","version":"1.0","type":"link"}