{"product_id":"proteintech-13113-1-ap","title":"Proteintech, 13113-1-AP, IL-36RN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-36RN (13113-1-AP) by Proteintech is a Polyclonal antibody targeting IL-36RN in IHC, ELISA applications with reactivity to human samples\n13113-1-AP targets IL-36RN in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL36RN is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). It inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3780 Product name: Recombinant human IL-1F5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC024747 Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD Predict reactive species\nFull Name: interleukin 1 family, member 5 (delta)\nCalculated Molecular Weight: 155 aa, 17 kDa\nGenBank Accession Number: BC024747\nGene Symbol: IL-36RN\nGene ID (NCBI): 26525\nRRID: AB_2877917\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869551382697,"sku":"13113-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13113-1-ap","provider":"Iright","version":"1.0","type":"link"}