{"product_id":"proteintech-13115-1-ap","title":"Proteintech, 13115-1-AP, VAMP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAMP1 (13115-1-AP) by Proteintech is a Polyclonal antibody targeting VAMP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13115-1-AP targets VAMP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAMP1, also named as synaptobrevin 1, is a member of the vesicle-associated membrane protein (VAMP)\/synaptobrevin family. VAMP1 is a part of the SNARE (soluble NSF-attachment protein receptor) complex. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP1 is involved in synaptic vesicle exocytosis, a fundamental step in neurotransmitter release.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3787 Product name: Recombinant human VAMP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023286 Sequence: MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIM Predict reactive species\nFull Name: vesicle-associated membrane protein 1 (synaptobrevin 1)\nCalculated Molecular Weight: 117 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC023286\nGene Symbol: VAMP1\nGene ID (NCBI): 6843\nRRID: AB_2214772\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991344809,"sku":"13115-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13115-1-ap","provider":"Iright","version":"1.0","type":"link"}