{"product_id":"proteintech-13157-1-ap","title":"Proteintech, 13157-1-AP, DNAJB9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJB9 (13157-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB9 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n13157-1-AP targets DNAJB9 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3789 Product name: Recombinant human DNAJB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-223 aa of BC028912 Sequence: SYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily B, member 9\nCalculated Molecular Weight: 223 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC028912\nGene Symbol: DNAJB9\nGene ID (NCBI): 4189\nRRID: AB_2877918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868965228713,"sku":"13157-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13157-1-ap","provider":"Iright","version":"1.0","type":"link"}