{"product_id":"proteintech-13169-1-ap","title":"Proteintech, 13169-1-AP, QKI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe QKI (13169-1-AP) by Proteintech is a Polyclonal antibody targeting QKI in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13169-1-AP targets QKI in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, PC-12 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nQKI (Quaking) is RNA-binding protein that plays a central role in myelinization (PMID: 16641098). It regulates pre-mRNA splicing, mRNA export and protein translation (PMID: 16641098). It acts upstream of or within several processes, including long-chain fatty acid biosynthetic process, positive regulation of macromolecule metabolic process and vasculogenesis. QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism. It is expressed in the frontal cortex of brain (PMID: 16342280).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3822 Product name: Recombinant human QKI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC019917 Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN Predict reactive species\nFull Name: quaking homolog, KH domain RNA binding (mouse)\nCalculated Molecular Weight: 341 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC019917\nGene Symbol: QKI\nGene ID (NCBI): 9444\nRRID: AB_2173138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868894744745,"sku":"13169-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13169-1-ap","provider":"Iright","version":"1.0","type":"link"}