{"product_id":"proteintech-13179-1-ap","title":"Proteintech, 13179-1-AP, STAT5A\/B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAT5A\/B (13179-1-AP) by Proteintech is a Polyclonal antibody targeting STAT5A\/B in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n13179-1-AP targets STAT5A\/B in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, 3T3-L1 cells,  Daudi cells,  DU 145 cells,  SGC-7901 cells\nPositive IP detected in: K-562 cells, 3T3-L1 cells\nPositive IHC detected in: human cervical cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAT5A, also named as STAT5, belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5A is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of STAT5A in myeloma and lymphoma associated with a TEL\/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of human STAT5A is found to induce the expression of BCL2L1\/BCL-X(L), which suggests the antiapoptotic function of STAT5A in cells. This antibody is a rabbit polyclonal antibody raised against 445-794 aa of human STAT5A, the homology between this segment and the corresponding segment of human STAT5B is 92%. It shows that this antibody can cross-react with STAT5B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine, cow\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3846 Product name: Recombinant human STAT5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 445-794 aa of BC027036 Sequence: ESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS Predict reactive species\nFull Name: signal transducer and activator of transcription 5A\nCalculated Molecular Weight: 794 aa, 92 kDa\nObserved Molecular Weight: 90-95 kDa\nGenBank Accession Number: BC027036\nGene Symbol: STAT5A\nGene ID (NCBI): 6776\nRRID: AB_2196760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42229\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858306729,"sku":"13179-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13179-1-ap","provider":"Iright","version":"1.0","type":"link"}