{"product_id":"proteintech-13186-1-ap","title":"Proteintech, 13186-1-AP, MLF1IP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MLF1IP (13186-1-AP) by Proteintech is a Polyclonal antibody targeting MLF1IP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13186-1-AP targets MLF1IP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse liver tissue,  mouse testis tissue,  rat liver tissue,  U-87 MG cells\nPositive IHC detected in: mouse colon tissue, human colon tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMLF1IP, also named as CENPU, ICEN24, KLIP1 and PBIP1, belongs to the CENP-U\/AME1 family. MLF1IP plays an important role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. Moreover, MLF1IP has been shown to be involved in tumorigenesis in several types of cancer including glioblastoma, prostate cancer and luminal breast cancer (PMID: 27378428). MLF1IP has 3 isoforms with the molecular mass of 21, 38 and 47 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3858 Product name: Recombinant human MLF1IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-418 aa of BC031520 Sequence: MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG Predict reactive species\nFull Name: MLF1 interacting protein\nCalculated Molecular Weight: 418 aa, 48 kDa\nObserved Molecular Weight: 46-50 kDa, 60 kDa\nGenBank Accession Number: BC031520\nGene Symbol: MLF1IP\nGene ID (NCBI): 79682\nRRID: AB_10642941\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q71F23\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869710438569,"sku":"13186-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13186-1-ap","provider":"Iright","version":"1.0","type":"link"}