{"product_id":"proteintech-13211-1-ap","title":"Proteintech, 13211-1-AP, UBA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBA6 (13211-1-AP) by Proteintech is a Polyclonal antibody targeting UBA6 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n13211-1-AP targets UBA6 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human brain tissue\nPositive IHC detected in: mouse testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBA6(Ubiquitin-like modifier-activating enzyme 6) is also named as MOP4, UBE1L2 and belongs to the ubiquitin-activating E1 family. It probably acts as a single molecule like UBE1 and not as a heterodimeric E1 complex, as formed by AOS1\/Uba2 and APP-BP1\/Uba3. UBA6 is even more restricted in distribution because it is only found in vertebrates but not in lower organisms so that it might have a specialized role in tissues of higher organisms, and in particular, in the testis, where it is expressed by far most abundantly.(PMID:17580310). It has 4 isoforms produced by alternative splicing. This antibody recognizes the full-length(118 kda) and the truncated isoform CRA_b (60-70 kDa) of UBA6 (NCBI).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4000 Product name: Recombinant human UBA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-389 aa of BC031637 Sequence: AVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY Predict reactive species\nFull Name: ubiquitin-like modifier activating enzyme 6\nCalculated Molecular Weight: 1052 aa, 118 kDa\nObserved Molecular Weight: 118 kDa\nGenBank Accession Number: BC031637\nGene Symbol: UBA6\nGene ID (NCBI): 55236\nRRID: AB_2211747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A0AVT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869624848553,"sku":"13211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13211-1-ap","provider":"Iright","version":"1.0","type":"link"}