{"product_id":"proteintech-13293-1-ap","title":"Proteintech, 13293-1-AP, MS4A12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MS4A12 (13293-1-AP) by Proteintech is a Polyclonal antibody targeting MS4A12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13293-1-AP targets MS4A12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3968 Product name: Recombinant human MS4A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC029793 Sequence: MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGL Predict reactive species\nFull Name: membrane-spanning 4-domains, subfamily A, member 12\nCalculated Molecular Weight: 267 aa, 28 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC029793\nGene Symbol: MS4A12\nGene ID (NCBI): 54860\nRRID: AB_10596915\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NXJ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887725400233,"sku":"13293-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13293-1-ap","provider":"Iright","version":"1.0","type":"link"}