{"product_id":"proteintech-13303-1-ap","title":"Proteintech, 13303-1-AP, VASH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VASH2 (13303-1-AP) by Proteintech is a Polyclonal antibody targeting VASH2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n13303-1-AP targets VASH2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, BxPC-3 cells,  L02 cells,  SW 1990 cells,  PANC-1 cells,  PC-12 cells\nPositive IHC detected in: human stomach cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVASH2, also named as vasohibin 2, is an important pro-angiogenesis factor in solid tumor. It has been reported that VASH2 is expressed in mononuclear cells mobilized from bone marrow to promote angiogenesis. VASH2 also plays a key role in axon formation. VASH2 is localized as a nuclear type(with 311 amino acid residues) and cytoplasmic type (with 355 amino acid residues and low abundance). Cytoplasmic VASH2 is associated with carcinoma angiogenesis, while nuclear VASH2 may be associated with cell proliferation. This antibody recognizes both the nuclear and cytoplasmic isoforms.(PMID:23615928; 19204325; 31235911; 26177649)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4121 Product name: Recombinant human VASH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC028194 Sequence: METAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKGLCSH Predict reactive species\nFull Name: vasohibin 2\nCalculated Molecular Weight: 355 aa, 40 kDa\nObserved Molecular Weight: 30-34 kDa\nGenBank Accession Number: BC028194\nGene Symbol: VASH2\nGene ID (NCBI): 79805\nRRID: AB_10642836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86V25\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869792096425,"sku":"13303-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13303-1-ap","provider":"Iright","version":"1.0","type":"link"}