{"product_id":"proteintech-13327-1-ap","title":"Proteintech, 13327-1-AP, VPS54 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS54 (13327-1-AP) by Proteintech is a Polyclonal antibody targeting VPS54 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n13327-1-AP targets VPS54 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  mouse pancreas tissue,  mouse testis tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4123 Product name: Recombinant human VPS54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 746-965 aa of BC030275 Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR Predict reactive species\nFull Name: vacuolar protein sorting 54 homolog (S. cerevisiae)\nCalculated Molecular Weight: 977 aa, 111 kDa\nObserved Molecular Weight: 90-93kDa, 111 kDa\nGenBank Accession Number: BC030275\nGene Symbol: VPS54\nGene ID (NCBI): 51542\nRRID: AB_2304414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P1Q0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869508751529,"sku":"13327-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13327-1-ap","provider":"Iright","version":"1.0","type":"link"}