{"product_id":"proteintech-13364-1-ap","title":"Proteintech, 13364-1-AP, ERGIC-53 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERGIC-53 (13364-1-AP) by Proteintech is a Polyclonal antibody targeting ERGIC-53 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13364-1-AP targets ERGIC-53 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  human brain tissue,  HeLa cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells,  mouse heart tissue,  mouse spleen tissue,  rat heart tissue,  rat spleen tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERGIC-53 (also known as LMAN1 or MR60) is a membrane mannose-specific lectin that selectively transports its cargo proteins from ER to ER-Golgi intermediate compartment (ERGIC) and Golgi, functioning as a cargo transport receptor for glycoproteins (PMID: 24664723; 10559958). Mutations in ERGIC-53 cause combined deficiency of coagulation factors V and VIII (PMID: 9546392).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4183 Product name: Recombinant human LMAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-401 aa of BC032330 Sequence: GDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILR Predict reactive species\nFull Name: lectin, mannose-binding, 1\nCalculated Molecular Weight: 510 aa, 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC032330\nGene Symbol: ERGIC-53\nGene ID (NCBI): 3998\nRRID: AB_2135994\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49257\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861354153,"sku":"13364-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13364-1-ap","provider":"Iright","version":"1.0","type":"link"}