{"product_id":"proteintech-13367-1-ap","title":"Proteintech, 13367-1-AP, SPA17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPA17 (13367-1-AP) by Proteintech is a Polyclonal antibody targeting SPA17 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13367-1-AP targets SPA17 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human testis tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSperm surface protein Sp17(SPA17)is a 151 amino acids protein (17kDa), which is a sperm surface peripheral membrane protein. It is a highly conserved mammalian protein expressed in developing spermatozoa and mature spermatids, and reported to play a role in the interaction of sperm with the zona pellucida. SP17 exists as a homodimer and localizes to the head and tail of spermatozoa. SP17 has been identified as a cancer\/testis antigen and is expressed in ovarian cancer and multiple myeloma. This suggests that SP17 could be suitable as a target in tumor immunotherapy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4186 Product name: Recombinant human SPA17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC032457 Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK Predict reactive species\nFull Name: sperm autoantigenic protein 17\nCalculated Molecular Weight: 151 aa, 17 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC032457\nGene Symbol: SPA17\nGene ID (NCBI): 53340\nRRID: AB_2194631\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15506\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989706409,"sku":"13367-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13367-1-ap","provider":"Iright","version":"1.0","type":"link"}