{"product_id":"proteintech-13418-1-ap","title":"Proteintech, 13418-1-AP, MED19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED19 (13418-1-AP) by Proteintech is a Polyclonal antibody targeting MED19 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13418-1-AP targets MED19 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMediator of RNA polymerase II transcription subunit 19 (MED19) is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (PMID: 12584197). Mediator complex is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors (PMID: 15175163). MED19 may be a novel proliferation regulator that promotes lung cancer and gastric cancer progression and cellular growth (PMID: 21519921, PMID: 22565189).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4165 Product name: Recombinant human MED19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC037223 Sequence: MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS Predict reactive species\nFull Name: mediator complex subunit 19\nCalculated Molecular Weight: 194 aa, 20 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC037223\nGene Symbol: MED19\nGene ID (NCBI): 219541\nRRID: AB_10644134\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A0JLT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869415755945,"sku":"13418-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13418-1-ap","provider":"Iright","version":"1.0","type":"link"}