{"product_id":"proteintech-13443-1-ap","title":"Proteintech, 13443-1-AP, KCNS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNS2 (13443-1-AP) by Proteintech is a Polyclonal antibody targeting KCNS2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13443-1-AP targets KCNS2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells,  HepG2 cells,  mouse brain tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4271 Product name: Recombinant human KCNS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC027932 Sequence: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSR Predict reactive species\nFull Name: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2\nCalculated Molecular Weight: 477 aa, 54 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC027932\nGene Symbol: KCNS2\nGene ID (NCBI): 3788\nRRID: AB_2249596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULS6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887692337321,"sku":"13443-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13443-1-ap","provider":"Iright","version":"1.0","type":"link"}