{"product_id":"proteintech-13447-1-ap","title":"Proteintech, 13447-1-AP, GCET2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCET2 (13447-1-AP) by Proteintech is a Polyclonal antibody targeting GCET2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n13447-1-AP targets GCET2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IF\/ICC detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCET2, also named HGAL, is a newly gene that has been shown to be a useful marker for germinal centre (GC) B cells and GC B-cell derived malignancies, including follicular lymphomas and germinal centre B cell-like diffuse large B-cell lymphomas (GCB-DLBCLs), and is a useful prognosticator for DLBCLs. GCET2 may be an adaptor protein in GC B cells that transduces signals from GC B-cell membrane to the cytosol via its association with GRB2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4280 Product name: Recombinant human GCET2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC030506 Sequence: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL Predict reactive species\nFull Name: germinal center expressed transcript 2\nCalculated Molecular Weight: 178 aa, 21 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC030506\nGene Symbol: GCET2\nGene ID (NCBI): 257144\nRRID: AB_2877949\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N6F7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887648624809,"sku":"13447-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13447-1-ap","provider":"Iright","version":"1.0","type":"link"}