{"product_id":"proteintech-13454-1-ap","title":"Proteintech, 13454-1-AP, Siglec-6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Siglec-6 (13454-1-AP) by Proteintech is a Polyclonal antibody targeting Siglec-6 in IHC, ELISA applications with reactivity to human samples\n13454-1-AP targets Siglec-6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSiglec-6, originally identified on trophoblast cells of the placenta, is highly and consistently expressed on MCs from both mucosal and non-mucosal sites. Siglec-6 consists of 3 extracellular immunoglobulin (Ig) domains and 2 intracellular immunoreceptor tyrosine-based inhibition motifs (ITIMs), closely resembling the molecular structure of Siglec-3 (CD33) (PMID: 34289026). Siglec-6 was recruited to placental expression during human evolution, presumably to interact with sialylated ligands for specific negative signaling functions and\/or to regulate leptin availability (PMID: 17580316). Siglec-6 is an immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptor selectively expressed by mast cells, making it a promising target for therapeutic intervention (PMID: 35406705).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4281 Product name: Recombinant human SIGLEC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-200 aa of BC035359 Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHST Predict reactive species\nFull Name: sialic acid binding Ig-like lectin 6\nCalculated Molecular Weight: 426 aa, 47 kDa\nGenBank Accession Number: BC035359\nGene Symbol: SIGLEC6\nGene ID (NCBI): 946\nRRID: AB_2189287\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43699\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869764047017,"sku":"13454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13454-1-ap","provider":"Iright","version":"1.0","type":"link"}