{"product_id":"proteintech-13461-2-ap","title":"Proteintech, 13461-2-AP, BPIL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BPIL1 (13461-2-AP) by Proteintech is a Polyclonal antibody targeting BPIL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13461-2-AP targets BPIL1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBactericidal\/permeability-increasing protein-like 1 (BPIL1, also known as LPLUNC2 or BPIFB2) is a member of the lipid transfer (LT)\/lipopolysaccharide binding protein (LBP) family. LT\/LBP proteins are structurally related proteins capable of binding phospholipids and lipopolysaccharides (PMID: 12185532). The gene of BPIL1 maps to Chromosome 20q11, and encodes a 458-amino acid protein with a calculated molecular weight of 49 kDa. It is highly expressed in hypertrophic tonsils. BPIL1 has been identified as a nasal mucous protein that may be involved in immune response in the nose against microbial infections (PMID: 15996010). Reduced expression of antimicrobial PLUNC proteins (LPLUNC1 and LPLUNC2) has been reported in nasal polyp tissues of patients with chronic rhinosinusitis (PMID: 22676062).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4051 Product name: Recombinant human BPIL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-424 aa of BC034415 Sequence: IILPTDATPFVLPRHVGTEGSMATGGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAM Predict reactive species\nFull Name: bactericidal\/permeability-increasing protein-like 1\nCalculated Molecular Weight: 458 aa, 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC034415\nGene Symbol: BPIL1\nGene ID (NCBI): 80341\nRRID: AB_2067089\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N4F0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869447213225,"sku":"13461-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13461-2-ap","provider":"Iright","version":"1.0","type":"link"}