{"product_id":"proteintech-13462-1-ap","title":"Proteintech, 13462-1-AP, IL-22RA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-22RA1 (13462-1-AP) by Proteintech is a Polyclonal antibody targeting IL-22RA1 in WB, IF, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n13462-1-AP targets IL-22RA1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HEK-293 cells,  HepG2 cells,  HT-29 cells,  mouse small intestine tissue,  mouse heart tissue\nPositive IF detected in: human gut\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF): IF : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4056 Product name: Recombinant human IL-22RA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 253-574 aa of BC029273 Sequence: YVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES Predict reactive species\nFull Name: interleukin 22 receptor, alpha 1\nCalculated Molecular Weight: 574 aa, 63 kDa\nObserved Molecular Weight: 63-68 kDa\nGenBank Accession Number: BC029273\nGene Symbol: IL-22RA1\nGene ID (NCBI): 58985\nRRID: AB_2248953\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N6P7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868885078185,"sku":"13462-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13462-1-ap","provider":"Iright","version":"1.0","type":"link"}