{"product_id":"proteintech-13474-1-ap","title":"Proteintech, 13474-1-AP, Cryptochrome 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cryptochrome 1 (13474-1-AP) by Proteintech is a Polyclonal antibody targeting Cryptochrome 1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n13474-1-AP targets Cryptochrome 1 in WB, IHC, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Y79 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCryptochrome circadian clock 1 (CRY1) is a flavin adenine dinucleotide-binding protein with MW of 66 kDa. CRY1 is a key component of the circadian core oscillator complex, which regulates the circadian clock. CRY1 predominantly displays evening-time expression and serves as a strong repressor of morning-time elements (E box\/E-prime box) when bound to the BMAL1 (ARNTL; 602550)\/CLOCK (601851) complex (PubMed: 21236481). This antibody can recognize CRY1 and CRY2 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4270 Product name: Recombinant human CRY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-586 aa of BC030519 Sequence: RPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN Predict reactive species\nFull Name: cryptochrome 1 (photolyase-like)\nCalculated Molecular Weight: 586 aa, 66 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: BC030519\nGene Symbol: CRY1\nGene ID (NCBI): 1407\nRRID: AB_10697652\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16526\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852474025,"sku":"13474-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13474-1-ap","provider":"Iright","version":"1.0","type":"link"}