{"product_id":"proteintech-13475-1-ap","title":"Proteintech, 13475-1-AP, SLC22A18AS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A18AS (13475-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A18AS in IP, ELISA applications with reactivity to human samples\n13475-1-AP targets SLC22A18AS in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SLC22A18\/SLC22A18AS genes are a sense-antisense pair located at human chromosome segment 11p15.5. These genes are paternally imprinted: paternal alleles are silenced and maternal alleles are expressed. SLC22A18AS (antisense) is associated to SLC22A18 (sense). These two genes share, in divergent orientations, 31 bp in their 5′ regions (between the first exon of SLC22A18AS and the second exon of SLC22A18). This antibody recognizes SLC22A18AS only.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4274 Product name: Recombinant human SLC22A18AS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC030237 Sequence: MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT Predict reactive species\nFull Name: solute carrier family 22 (organic cation transporter), member 18 antisense\nCalculated Molecular Weight: 253 aa, 27 kDa\nObserved Molecular Weight: 30 kDa, 65 kDa\nGenBank Accession Number: BC030237\nGene Symbol: SLC22A18AS\nGene ID (NCBI): 5003\nRRID: AB_2877953\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N1D0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804207273,"sku":"13475-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13475-1-ap","provider":"Iright","version":"1.0","type":"link"}