{"product_id":"proteintech-13486-1-ap","title":"Proteintech, 13486-1-AP, PIAS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIAS3 (13486-1-AP) by Proteintech is a Polyclonal antibody targeting PIAS3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13486-1-AP targets PIAS3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIAS3(E3 SUMO-protein ligase PIAS3) is a protein of 583 amino acid, has a molecular mass of 68 kDa and belongs to a family of proteins that includes several other members(PMID:11060035). PIAS3 is an inhibitor of activated STAT3 and binds microphthalmia-associated transcription factor, which is a key DNA-binding protein, in rat basophilic leukemia cells and mouse melanocytes(PMID:11709556). The PIAS3 antibody detects PIAS3 (68 kDa) as well as its sumoylated form (85 kDa) in some normal mouse tissues, breast and brain tumor cell lines(PMID:20371673).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4304 Product name: Recombinant human PIAS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 277-628 aa of BC030556 Sequence: VRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD Predict reactive species\nFull Name: protein inhibitor of activated STAT, 3\nCalculated Molecular Weight: 628 aa, 68 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC030556\nGene Symbol: PIAS3\nGene ID (NCBI): 10401\nRRID: AB_2164224\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6X2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986658985,"sku":"13486-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13486-1-ap","provider":"Iright","version":"1.0","type":"link"}