{"product_id":"proteintech-13489-1-ap","title":"Proteintech, 13489-1-AP, NLGN4Y Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NLGN4Y (13489-1-AP) by Proteintech is a Polyclonal antibody targeting NLGN4Y in WB, ELISA applications with reactivity to human samples\n13489-1-AP targets NLGN4Y in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  PC-3 cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNLGN4Y, one member of Neuroligins, is cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses , NLGN4Y was expressed in fetal and adult brain, prostate, testis, pancreas. NLGN4Y is homologous with its X-linked homolog, NLGN4X. The antibody can recognize both of NLGN4Y and NLGN4X at 72kDa mature form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4311 Product name: Recombinant human NLGN4Y protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC032567 Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEAR Predict reactive species\nFull Name: neuroligin 4, Y-linked\nCalculated Molecular Weight: 816 aa, 92 kDa\nObserved Molecular Weight: 92 kDa\nGenBank Accession Number: BC032567\nGene Symbol: NLGN4Y\nGene ID (NCBI): 22829\nRRID: AB_2235981\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFZ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887738540201,"sku":"13489-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13489-1-ap","provider":"Iright","version":"1.0","type":"link"}