{"product_id":"proteintech-13497-1-ap","title":"Proteintech, 13497-1-AP, OTX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OTX2 (13497-1-AP) by Proteintech is a Polyclonal antibody targeting OTX2 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n13497-1-AP targets OTX2 in WB, IHC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, mouse retina tissue,  rat retina tissue\nPositive IP detected in: Y79 cells\nPositive IHC detected in: mouse eye tissue, rat eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe orthodenticle homeobox 2, encoded by OTX2 gene, is a key transcription factor in developmental processes. In particular, it is required for the early specification of the brain and the embryonic development of sensory organs, including the, pineal gland, pituitary gland, inner part of the ear, eyes, and optic nerve. In later stages, it is important for maintaining intact retina and brain function. In addition, it acts as a transcriptional repressor and a gatekeeper of myogenic and neuronal differentiation in medulloblastoma cells. OTX2 binds to the MyoD1 core enhancer through its homeobox domain and the remarkable repressor activity exhibited by the homeobox domain renders OTX2 transcriptionally repressive\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4323 Product name: Recombinant human OTX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-297 aa of BC032579 Sequence: MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL Predict reactive species\nFull Name: orthodenticle homeobox 2\nCalculated Molecular Weight: 297 aa, 32 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC032579\nGene Symbol: OTX2\nGene ID (NCBI): 5015\nRRID: AB_2157176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32243\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868854603945,"sku":"13497-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13497-1-ap","provider":"Iright","version":"1.0","type":"link"}