{"product_id":"proteintech-13506-1-ap","title":"Proteintech, 13506-1-AP, TAF7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAF7 (13506-1-AP) by Proteintech is a Polyclonal antibody targeting TAF7 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13506-1-AP targets TAF7 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  MCF-7 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAF7, also named as Transcription initiation factor TFIID 55 kDa subunit, is a 349 amino acid protein, which belongs to the TAF7 family. TAF7 functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF7 is phosphorylated by CIITA. The calcualted molecular weight of TAF7 is 40 kDa, but phosphorylated TAF7 is about 55kDa. (PMID: 22711989)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4406 Product name: Recombinant human TAF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC032737 Sequence: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK Predict reactive species\nFull Name: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa\nCalculated Molecular Weight: 349 aa, 40 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC032737\nGene Symbol: TAF7\nGene ID (NCBI): 6879\nRRID: AB_2271400\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15545\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869611217065,"sku":"13506-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13506-1-ap","provider":"Iright","version":"1.0","type":"link"}