{"product_id":"proteintech-13508-1-ap","title":"Proteintech, 13508-1-AP, MTPN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTPN (13508-1-AP) by Proteintech is a Polyclonal antibody targeting MTPN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13508-1-AP targets MTPN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, human brain tissue,  HeLa cells,  Jurkat cells\nPositive IHC detected in: human normal colon, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyotrophin (MTPN) is a ubiquitously expressed 12 kDa cytoplamic protein that was first isolated from the hearts of spontaneously hypertensive rats. Protein sequence analysis revealed that MTPN was composed of 118 amino acids and was occupied by two and a half internal 33 amino acid ankyrin repeats. MTPN stimulates protein synthesis and increases the expression of a number of cardiac marker genes (such as atrial natriuretic factor and b-myosin heavy chain) in cardiomyocytes leading to hypertrophy. In skeletal muscle, MTPN is also a positive growth factor in promoting skeletal muscle growth.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4419 Product name: Recombinant human MTPN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC028093 Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ Predict reactive species\nFull Name: myotrophin\nCalculated Molecular Weight: 118 aa, 13 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC028093\nGene Symbol: MTPN\nGene ID (NCBI): 136319\nRRID: AB_2148129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58546\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869562949801,"sku":"13508-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13508-1-ap","provider":"Iright","version":"1.0","type":"link"}