{"product_id":"proteintech-13521-1-ap","title":"Proteintech, 13521-1-AP, Glypican 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Glypican 2 (13521-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican 2 in WB, ELISA applications with reactivity to human, mouse samples\n13521-1-AP targets Glypican 2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, unboiled mouse brain tissue,  unboiled rat brain tissue,  T-47D cells,  mouse spleen tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlypican 2 (GPC2) is a heparan sulfate proteoglycan that is linked to the outer leaflet of the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage(PMID: 18505598). It is expected to be located in cell membrane and highly overexpressed in a high percentage of human neuroblastomas, medulloblastomas, and retinoblastomas. The calculated molecular weight of GPC2 is 62 kDa. And other bands are the result of glycosylation modification. Recent studies demonstrate that expression of the GPC2 protein is significantly increased in neuroblastoma and undetectable in normal tissues, including brain, heart, lung, and kidney, indicating that GPC2 is a suitable tumor antigen in neuroblastoma (PMID: 30352677).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4041 Product name: Recombinant human GPC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC027972 Sequence: MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQ Predict reactive species\nFull Name: glypican 2\nCalculated Molecular Weight: 579 aa, 63 kDa\nObserved Molecular Weight: 62，70-100 kDa\nGenBank Accession Number: BC027972\nGene Symbol: GPC2\nGene ID (NCBI): 221914\nRRID: AB_3085417\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887652851881,"sku":"13521-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13521-1-ap","provider":"Iright","version":"1.0","type":"link"}