{"product_id":"proteintech-13544-1-ap","title":"Proteintech, 13544-1-AP, PDSS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDSS2 (13544-1-AP) by Proteintech is a Polyclonal antibody targeting PDSS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13544-1-AP targets PDSS2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells, A375 cells\nPositive IHC detected in: human kidney tissue, human liver cancer tissue,  mouse liver tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDSS2, also named as C6orf210, is required for the synthesis of coenzyme Q10 (CoQ10), which is synthesized in the mitochondrial inner membrane and plays a vital role in the mitochondrial respiratory chain, pyrimidine nucleoside biosynthesis, and modulation of apoptosis (PMID:25330808). An increasing body of evidence suggests that PDSS2 is a tumor suppressor gene in certain cancers, such as melanoma, gastric cancer and non-small cell lung cancer. Besides, PDSS2 could be used as a prognostic biomarker for HCC (PMID:25780306). PDSS2 has 2 isoforms with MW of 44 kDa and 27 kDa while 13544-1-AP antibody detects the bands around 27-30 kDa and 44-47 kDa in SDS-PAGE.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4487 Product name: Recombinant human PDSS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC039906 Sequence: MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDI Predict reactive species\nFull Name: prenyl (decaprenyl) diphosphate synthase, subunit 2\nCalculated Molecular Weight: 399 aa, 44 kDa\nObserved Molecular Weight: 27-30 kDa, 44-47 kDa\nGenBank Accession Number: BC039906\nGene Symbol: PDSS2\nGene ID (NCBI): 57107\nRRID: AB_10598311\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YH6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971716777,"sku":"13544-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13544-1-ap","provider":"Iright","version":"1.0","type":"link"}