{"product_id":"proteintech-13547-1-ap","title":"Proteintech, 13547-1-AP, TFEC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFEC (13547-1-AP) by Proteintech is a Polyclonal antibody targeting TFEC in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n13547-1-AP targets TFEC in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  COLO 320 cells\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe DNA-binding factor TFE3 contains adjacent helix-loop-helix (HLH) and leucine zipper (LZ) domains flanked by an upstream basic region. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. TFEC shares a bHLH\/LZ structure with TFE3 and a closely related protein microphthalmia-associated transcription factor (MITF), which is critically involved in melanocyte differentiation. The expression of TFEC is mainly in fibroblasts, myoblasts, chondrosarcoma cells and myeloma cells. 50kDa TFEC isoforms are produced by alternative splicing (PMID: 29303964, PMID: 11467950).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4061 Product name: Recombinant human TFEC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC029891 Sequence: MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQVFIRM Predict reactive species\nFull Name: transcription factor EC\nCalculated Molecular Weight: 347 aa, 39 kDa\nObserved Molecular Weight: 35-40 kDa, 65 kDa\nGenBank Accession Number: BC029891\nGene Symbol: TFEC\nGene ID (NCBI): 22797\nRRID: AB_2199629\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14948\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887826358441,"sku":"13547-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13547-1-ap","provider":"Iright","version":"1.0","type":"link"}