{"product_id":"proteintech-13581-1-ap","title":"Proteintech, 13581-1-AP, FAU Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAU (13581-1-AP) by Proteintech is a Polyclonal antibody targeting FAU in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13581-1-AP targets FAU in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, mouse liver tissue\nPositive IHC detected in: human stomach tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4504 Product name: Recombinant human FAU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC033877 Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS Predict reactive species\nFull Name: Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed\nCalculated Molecular Weight: 133 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC033877\nGene Symbol: FAU\nGene ID (NCBI): 2197\nRRID: AB_2100970\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406154921,"sku":"13581-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13581-1-ap","provider":"Iright","version":"1.0","type":"link"}