{"product_id":"proteintech-13595-1-ap","title":"Proteintech, 13595-1-AP, Tenascin-X Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Tenascin-X (13595-1-AP) by Proteintech is a Polyclonal antibody targeting Tenascin-X in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13595-1-AP targets Tenascin-X in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HT-1080 cells,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human kidney tissue, human heart tissue,  human lung tissue,  human breast cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTenascin-X (TNXB) is an extracellular matrix glycoprotein predominantly located in the outer reticular lamina of the basement membrane (BM) (PMID: 23768946). It interacts with many other ECM proteins and it accelerates collagen fibrillogenesis in vitro. TNXB plays a role in interactions between cell and ECM, antiadhesive effect, inhibiting cell migration, and in maintaining homeostasis of the extracellular matrix. Deficiency of TNXB has been associated with the connective tissue disorder Ehlers-Danlos syndrome. This antibody is raised against human TNXB and detects a band of about 75 kDa, which probably represents a proteolytic cleaved form of human TNXB (PMID: 17263730). But the serum form of tenascin-X is a 140-kD protein probably resulting from proteolytic cleavage or alternative splicing of tenascin-X(PMID: 16567571, 11642233).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4501 Product name: Recombinant human TNXB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-673 aa of BC033740 Sequence: PGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG Predict reactive species\nFull Name: tenascin XB\nCalculated Molecular Weight: 4289 aa, 464 kDa\nObserved Molecular Weight: 75 kDa, 140 kDa\nGenBank Accession Number: BC033740\nGene Symbol: TNXB\nGene ID (NCBI): 7148\nRRID: AB_10644124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22105\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990296233,"sku":"13595-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13595-1-ap","provider":"Iright","version":"1.0","type":"link"}