{"product_id":"proteintech-13599-1-ap","title":"Proteintech, 13599-1-AP, SUR2\/ABCC9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUR2\/ABCC9 (13599-1-AP) by Proteintech is a Polyclonal antibody targeting SUR2\/ABCC9 in WB, ELISA applications with reactivity to human, mouse samples\n13599-1-AP targets SUR2\/ABCC9 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  unboiled mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCC9, also known as SUR2, belongs to the ABC transporter superfamily. ABCC9 is a subunit of ATP-sensitive potassium channels (KATP), forming cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation (PMID: 9831708). ABCC9 is thought to form ATP-sensitive potassium channels in cardiac, skeletal, vascular, and non-vascular smooth muscle. Defects in ABCC9 cause dilated cardiomyopathy 10 and familial atrial fibrillation type 12 (ATFB12)(PMID: 15034580,17245405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4536 Product name: Recombinant human ABCC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC033804 Sequence: MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHHNTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIVYYHNIETSNFPKLLLGFSHHESKSCYQHS Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 9\nCalculated Molecular Weight: 1549 aa, 174 kDa\nObserved Molecular Weight: 174 kDa\nGenBank Accession Number: BC033804\nGene Symbol: SUR2\/ABCC9\nGene ID (NCBI): 10060\nRRID: AB_3085419\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60706\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819706537,"sku":"13599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13599-1-ap","provider":"Iright","version":"1.0","type":"link"}