{"product_id":"proteintech-13600-1-ap","title":"Proteintech, 13600-1-AP, LSAMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSAMP (13600-1-AP) by Proteintech is a Polyclonal antibody targeting LSAMP in WB, ELISA applications with reactivity to human, mouse, rat samples\n13600-1-AP targets LSAMP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLSAMP, also known as LAMP, is a 64-68 kDa heavily glycosylated neural cell adhesion molecule expressed on the neuronal dendrites and somata (PMID: 1688937; 8666243). LSAMP is a member of the IgLON family. The amino acid sequence of LSAMP is highly conserved among species. Human LSAMP shares 99% amino acid sequence identity with rodent LSAMP. The impact of LSAMP protein on neurite outgrowth and neuronal connectivity has been established in a wide spectrum of psychiatric disorders in humans (PMID: 26136648). In mice, lack of LSAMP protein seemingly leads to a deterioration in the ability to adapt to novel stressful environments and stimuli (PMID: 22155487).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4542 Product name: Recombinant human LSAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-322 aa of BC033803 Sequence: FNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAV Predict reactive species\nFull Name: limbic system-associated membrane protein\nCalculated Molecular Weight: 338 aa, 37 kDa\nObserved Molecular Weight: 64-68 kDa\nGenBank Accession Number: BC033803\nGene Symbol: LSAMP\nGene ID (NCBI): 4045\nRRID: AB_10597712\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13449\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709081769,"sku":"13600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13600-1-ap","provider":"Iright","version":"1.0","type":"link"}