{"product_id":"proteintech-13605-1-ap","title":"Proteintech, 13605-1-AP, POU2AF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POU2AF1 (13605-1-AP) by Proteintech is a Polyclonal antibody targeting POU2AF1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13605-1-AP targets POU2AF1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, mouse lung tissue\nPositive IF\/ICC detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4482 Product name: Recombinant human POU2AF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC032549 Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF Predict reactive species\nFull Name: POU class 2 associating factor 1\nCalculated Molecular Weight: 256 aa, 27 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC032549\nGene Symbol: POU2AF1\nGene ID (NCBI): 5450\nENSEMBL Gene ID: ENSG00000110777\nRRID: AB_2252633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16633\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887769047209,"sku":"13605-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13605-1-ap","provider":"Iright","version":"1.0","type":"link"}