{"product_id":"proteintech-13620-1-ap","title":"Proteintech, 13620-1-AP, ST3GAL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ST3GAL2 (13620-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13620-1-AP targets ST3GAL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 205 cells, HL-60 cells,  HT-29 cells,  LoVo cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta-galactoside alpha-2,3-sialyltransferase 2 (ST3GAL2) is a sialyltransferase (ST) that transfers sialic acid from the activated donor CMP-sialic acid to the glycan terminus of a glycolipid or glycoprotein. ST3GAL2 contains two putative N-glycosylation sites (Asn92 and Asn211), which are mainly responsible for GD1a and GT1b ganglioside biosynthesis in the brain. ST3GAL2 belongs to the sialyltransferase family, which mediates the terminal modification of glycoproteins and glycolipids. ST3GAL2 has been found to play a role in obesity, aging, and malignant diseases (PMID: 34319453). The calculated molecular weight of ST3GAL2 is 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4528 Product name: Recombinant human ST3GAL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-210 aa of BC036777 Sequence: SHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPA Predict reactive species\nFull Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 2\nCalculated Molecular Weight: 350 aa, 40 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: BC036777\nGene Symbol: ST3GAL2\nGene ID (NCBI): 6483\nRRID: AB_2286561\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16842\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869772173481,"sku":"13620-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13620-1-ap","provider":"Iright","version":"1.0","type":"link"}