{"product_id":"proteintech-13621-1-ap","title":"Proteintech, 13621-1-AP, ADAT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAT2 (13621-1-AP) by Proteintech is a Polyclonal antibody targeting ADAT2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13621-1-AP targets ADAT2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells,  mouse brain tissue,  mouse pancreas tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human hepatocirrhosis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAT2(tRNA-specific adenosine deaminase 2) is also named as DEADC1 and Belongs to the cytidine and deoxycytidylate deaminase family. It is a 24-kDa molecular mass protein that harbors all the conserved motifs required for deamination. ADAT2 and ADAT3 can function as a heterodimer which catalyses inosine formation at the wobble position (position 34) in eukaryotic tRNAs(PMID:12457566). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4529 Product name: Recombinant human ADAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-193 aa of BC037955 Sequence: HMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS Predict reactive species\nFull Name: adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae)\nCalculated Molecular Weight: 191 aa, 21 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC037955\nGene Symbol: ADAT2\nGene ID (NCBI): 134637\nRRID: AB_10642142\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z6V5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869631664297,"sku":"13621-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13621-1-ap","provider":"Iright","version":"1.0","type":"link"}