{"product_id":"proteintech-13643-1-ap","title":"Proteintech, 13643-1-AP, AHSP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AHSP (13643-1-AP) by Proteintech is a Polyclonal antibody targeting AHSP in WB, IHC, ELISA applications with reactivity to human, mouse, pig samples\n13643-1-AP targets AHSP in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig bone marrow tissue\nPositive IHC detected in: human placenta tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAHSP acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development, and specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia (PMID: 12066189).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4588 Product name: Recombinant human ERAF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC035842 Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS Predict reactive species\nFull Name: erythroid associated factor\nCalculated Molecular Weight: 102 aa, 12 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC035842\nGene Symbol: AHSP\nGene ID (NCBI): 51327\nRRID: AB_3669167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZD4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869805727913,"sku":"13643-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13643-1-ap","provider":"Iright","version":"1.0","type":"link"}