{"product_id":"proteintech-13661-1-ap","title":"Proteintech, 13661-1-AP, CRMP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRMP4 (13661-1-AP) by Proteintech is a Polyclonal antibody targeting CRMP4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13661-1-AP targets CRMP4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human colon tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDPYSL3(Dihydropyrimidinase-related protein 3) is also named as CRMP4, DRP3, ULIP, ULIP1 and belongs to the hydantoinase\/dihydropyrimidinase subfamily.DPYSL3 is a developmentally regulated protein, strongly expressed in early embryonic post-mitotic neural cells, reaching a peak of expression around the first post-natal week. In the adult brain, DPYSL3 is present mainly in regions that retain neurogenesis.DPYSL3 protein is also found in synaptic sites at the adult neuromuscular junction where it may be involved in the maintenance of neuronal stability(PMID: 16135096).It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4557 Product name: Recombinant human DPYSL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-570 aa of BC039006 Sequence: EGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS Predict reactive species\nFull Name: dihydropyrimidinase-like 3\nCalculated Molecular Weight: 570 aa, 62 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC039006\nGene Symbol: CRMP4\nGene ID (NCBI): 1809\nRRID: AB_10638641\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14195\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996128937,"sku":"13661-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13661-1-ap","provider":"Iright","version":"1.0","type":"link"}