{"product_id":"proteintech-13686-1-ap","title":"Proteintech, 13686-1-AP, PGK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGK2 (13686-1-AP) by Proteintech is a Polyclonal antibody targeting PGK2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n13686-1-AP targets PGK2 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  HeLa cells,  HepG2 cells,  human heart tissue,  human testis tissue,  mouse brain tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGK2, phosphoglycerate kinase 2, which belongs to the phosphoglycerate kinase superfamily. It catalyzes the first ATP-generating step in the central metabolic pathway of glycolysis, converting 1,3-bisphosphoglycerate and ADP to 3-phosphoglycerate and ATP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4553 Product name: Recombinant human PGK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-360 aa of BC038843 Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV Predict reactive species\nFull Name: phosphoglycerate kinase 2\nCalculated Molecular Weight: 417 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC038843\nGene Symbol: PGK2\nGene ID (NCBI): 5232\nRRID: AB_2161237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07205\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986364073,"sku":"13686-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13686-1-ap","provider":"Iright","version":"1.0","type":"link"}