{"product_id":"proteintech-13721-1-ap","title":"Proteintech, 13721-1-AP, Phospholemman\/FXYD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Phospholemman\/FXYD1 (13721-1-AP) by Proteintech is a Polyclonal antibody targeting Phospholemman\/FXYD1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13721-1-AP targets Phospholemman\/FXYD1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue, rat skeletal muscle tissue,  mouse skeletal muscle tissue,  rat heart tissue,  mouse heart tissue,  mouse kidney tissue,  human brain tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: mouse heart tissue, human skeletal muscle tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1500\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4669 Product name: Recombinant human FXYD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC032800 Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 1\nCalculated Molecular Weight: 92 aa, 10 kDa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: BC032800\nGene Symbol: FXYD1\nGene ID (NCBI): 5348\nRRID: AB_2108296\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00168\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864958633,"sku":"13721-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13721-1-ap","provider":"Iright","version":"1.0","type":"link"}