{"product_id":"proteintech-13727-1-ap","title":"Proteintech, 13727-1-AP, GRK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRK3 (13727-1-AP) by Proteintech is a Polyclonal antibody targeting GRK3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13727-1-AP targets GRK3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HL-60 cells\nPositive IHC detected in: mouse brain tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRK3 (G protein coupled receptor kinase 3), also known as ADRBK2 or BARK2, belongs to the G protein coupled receptor kinases (GRKs) family. GRKs are serine\/threonine kinases that regulate a large and diverse class of G-protein coupled receptors (GPCRs). GRKs have been shown to play a critical role in the outcome of a variety of physiological and pathophysiological processes including chemotaxis, signaling, migration, inflammatory gene expression and so on (PMID: 28950947, 29483837). GRK3 was identified as a negative regulator of CXCL12\/CXCR4 signaling, and has also been shown to be overexpressed in human prostate cancer and found to promote tumor growth and metastasis by enhancing angiogenesis (PMID: 23935208, 24434559). GRK3 has a molecular mass of 75-80 kDa, and also can be ubiquitinated (PMID: 20596523).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4685 Product name: Recombinant human ADRBK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-387 aa of BC036797 Sequence: MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRG Predict reactive species\nFull Name: adrenergic, beta, receptor kinase 2\nCalculated Molecular Weight: 688 aa, 80 kDa\nObserved Molecular Weight: 70 kDa, 90 kDa\nGenBank Accession Number: BC036797\nGene Symbol: GRK3\nGene ID (NCBI): 157\nRRID: AB_2225851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35626\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887659831465,"sku":"13727-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13727-1-ap","provider":"Iright","version":"1.0","type":"link"}