{"product_id":"proteintech-13753-1-ap","title":"Proteintech, 13753-1-AP, RNASET2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNASET2 (13753-1-AP) by Proteintech is a Polyclonal antibody targeting RNASET2 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13753-1-AP targets RNASET2 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: transfected cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNASET2(Ribonuclease T2) is also named as RNASE6PL(Ribonuclease 6) and belongs to the RNase T2 family. It is a unique member of the growing family of tumor-antagonizing genes and behaves as a class II tumor suppressor and abolish the tumorigenic potential of an ovarian cancer-derived cell line. This protein has 2 isoforms produced by alternative splicing. Both mildly glycosylated (ranging from38 to 45 kDa) and highly glycosylated forms (ranging from 50 to 80 kDa) of human tumor suppressor protein RNASET2 can be detected in immunoblotting in P. Pastoris(PMID: 21446958).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4695 Product name: Recombinant human RNASET2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-256 aa of BC039713 Sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH Predict reactive species\nFull Name: ribonuclease T2\nCalculated Molecular Weight: 256 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC039713\nGene Symbol: RNase T2\nGene ID (NCBI): 8635\nRRID: AB_2285339\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00584\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987969705,"sku":"13753-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-13753-1-ap","provider":"Iright","version":"1.0","type":"link"}